DPCstruct | MC12879
Metacluster Properties and Pfam Annotations
| Number of structural domains | 73 |
|---|---|
| Mean domain length (aa) | 418 ± 98 aa |
| Standard deviation of domain lengths | 98.27 |
| Length coefficient of variation | 0.24 |
| Mean AlphaFold2 pLDDT confidence score | 90.30 |
| Mean fraction of residues predicted as intrinsically disordered | 0.28 |
| Mean length-normalized TM-Score | 0.67 |
| Mean intra-cluster local Distance Difference Test score | 0.53 |
| Mean intra-cluster sequence similarity (%) | 18.40 |
| Pfam Score | 100.00 |
| Assigned Pfam label(s) | CL0317 |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A3D5M339 | 49-522 | FVTPFQCAVCHPDQFSQWDNSRMAHTGLNSWVYDLYDGTGTAGGSGGFVYTRDSVHAGDAPDGSCASCHQPESWIAQPFTPLAPLSG… |
| A0A1W1H9B1 | 2-392 | QWENSLHHFSHKDLIYKSTSDYLRKGLKDPDEIKEAESCVKCHTPVGFITGYPAKTSDDRTRIPKLAQKGIQCDYCHSATTAEKIYN… |
| A0A2E6EP95 | 182-618 | None |
| A0A521ZTP0 | 1-427 | None |
| A0A3M8FRS5 | 290-816 | None |
| A0A7Y5N0T3 | 327-748 | None |
| A0A3C2AHK6 | 2-255 | None |
| A0A2E7TVI4 | 4-513 | None |
| A0A2S8FE47 | 170-656 | None |
| A6GGX5 | 4-372 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.