DPCstruct | MC12876
Metacluster Properties and Pfam Annotations
| Number of structural domains | 19 |
|---|---|
| Mean domain length (aa) | 110 ± 10 aa |
| Standard deviation of domain lengths | 10.42 |
| Length coefficient of variation | 0.09 |
| Mean AlphaFold2 pLDDT confidence score | 72.12 |
| Mean fraction of residues predicted as intrinsically disordered | 0.66 |
| Mean length-normalized TM-Score | 0.58 |
| Mean intra-cluster local Distance Difference Test score | 0.82 |
| Mean intra-cluster sequence similarity (%) | 28.48 |
| Pfam Score | 100.00 |
| Assigned Pfam label(s) | CL0214 |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A3R7M108 | 3-100 | RQSDVQESMKNISNRAEKAVEVRKYDEKGVQERMQRLHADVLQKKLAEKKRMDDLAQIPLEEADVVLLMRELGCDRAAAELQLREKK… |
| A0A0H5R794 | 13-111 | EENRCEEREEARDLERVTDFVEESELDADRMSNVMSIFEKEEKTNQAAKAARDKELRLVKVDPNNVKLVAAQMDIDEELAEQVLRES… |
| A0A815UZZ4 | 21-127 | None |
| A0A2U1PJI5 | 23-134 | None |
| A0A433QB07 | 75-189 | None |
| A0A0S4KIP0 | 11-107 | None |
| A0A7J6PMF2 | 8-133 | None |
| A0A2H5RS66 | 57-183 | None |
| E1ZLY9 | 1-113 | None |
| A0A3Q0SAQ2 | 1-114 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.