DPCstruct | MC12873
Metacluster Properties and Pfam Annotations
| Number of structural domains | 33 |
|---|---|
| Mean domain length (aa) | 229 ± 35 aa |
| Standard deviation of domain lengths | 35.35 |
| Length coefficient of variation | 0.15 |
| Mean AlphaFold2 pLDDT confidence score | 85.26 |
| Mean fraction of residues predicted as intrinsically disordered | 0.25 |
| Mean length-normalized TM-Score | 0.62 |
| Mean intra-cluster local Distance Difference Test score | 0.61 |
| Mean intra-cluster sequence similarity (%) | 21.27 |
| Pfam Score | 100.00 |
| Assigned Pfam label(s) | PF01944 |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| L9UH79 | 48-295 | SFLVVGVISSILLLVDVVAFMSLVTMIVLLPALDLLKMALYVNYRGRLEPPAMPEQSLWTQFRGGVGRGWREMVAYVRDTPLLHAAV… |
| A0A497JCC8 | 4-182 | SLKLFIFGFLLGILLSFIFPSLYNLIFGALQERMEAQSKIVSNPFIGILLNNITASFITAYGGVFLTRLFLFLKSDEKSLKYSLFLF… |
| A0A376EHL8 | 4-253 | None |
| A0A6A8AUN7 | 6-201 | None |
| A0A7Z9ZLZ4 | 23-245 | None |
| A0A1D2X111 | 193-415 | None |
| U1P705 | 191-396 | None |
| A0A3D2C7W2 | 78-365 | None |
| A0A7T5ES69 | 31-279 | None |
| A0A6N9Q6H7 | 40-266 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.