DPCstruct | MC12872
Metacluster Properties and Pfam Annotations
| Number of structural domains | 50 |
|---|---|
| Mean domain length (aa) | 84 ± 10 aa |
| Standard deviation of domain lengths | 9.51 |
| Length coefficient of variation | 0.11 |
| Mean AlphaFold2 pLDDT confidence score | 72.10 |
| Mean fraction of residues predicted as intrinsically disordered | 0.32 |
| Mean length-normalized TM-Score | 0.72 |
| Mean intra-cluster local Distance Difference Test score | 0.67 |
| Mean intra-cluster sequence similarity (%) | 28.11 |
| Pfam Score | 100.00 |
| Assigned Pfam label(s) | PF18545 |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| L9Z6J0 | 3-74 | VRQIEGSDSPSQTVLRAVATETNTPVLELEPLYDTIDPEALNTLVTGNGAVRVAFDYQDFTVTVDAERVVLE |
| D3SYC0 | 3-84 | EITVETQADDSVSTVVVEAVAEAVGVDATALPPLYERVDPDALDAVFAPTATGAPRTGEIQFSYSEYVVTVGCDGDEIAITL |
| A0A5P9P8M8 | 20-101 | None |
| M0CU50 | 26-96 | None |
| V4IZU5 | 40-137 | None |
| A0A346PIX4 | 4-93 | None |
| A0A346PME5 | 1-74 | None |
| A0A346PSF7 | 52-130 | None |
| A0A1I2LHS8 | 9-101 | None |
| A0A1H3HFB8 | 1-99 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.