DPCstruct | MC12870
Metacluster Properties and Pfam Annotations
| Number of structural domains | 10 |
|---|---|
| Mean domain length (aa) | 307 ± 23 aa |
| Standard deviation of domain lengths | 22.75 |
| Length coefficient of variation | 0.07 |
| Mean AlphaFold2 pLDDT confidence score | 91.77 |
| Mean fraction of residues predicted as intrinsically disordered | 0.18 |
| Mean length-normalized TM-Score | 0.85 |
| Mean intra-cluster local Distance Difference Test score | 0.75 |
| Mean intra-cluster sequence similarity (%) | 39.20 |
| Pfam Score | 0.00 |
| Assigned Pfam label(s) | UNKNOWN |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A7C8IE00 | 246-535 | KEGESVGQWRDSGIGLGGGRIPYDVNTALVPAALRAIAALSRAGFFADHLDWNETADQYAKVWEDETLRFFEVSISQADAVSLVERY… |
| A0A7W1QLI3 | 1-320 | PRRDAAHWRSASWRDSDAGYAGGRFAMDVNAIWAPQALESIRLILVALPQLGLGKEDIRSFSPTTGGAQLAAYLADPAALDRAIETW… |
| A0A7W1EAY2 | 451-771 | None |
| A0A4U0X8V0 | 336-641 | None |
| A0A5Q3GDT6 | 950-1257 | None |
| A0A364NFF2 | 576-868 | None |
| A0A0N1HHS0 | 493-750 | None |
| A0A534DFN3 | 92-397 | None |
| A0A430L037 | 1-347 | None |
| A0A2S6C2I6 | 706-1030 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.