DPCstruct | MC1287
Metacluster Properties and Pfam Annotations
| Number of structural domains | 14 |
|---|---|
| Mean domain length (aa) | 97 ± 2 aa |
| Standard deviation of domain lengths | 1.82 |
| Length coefficient of variation | 0.02 |
| Mean AlphaFold2 pLDDT confidence score | 88.43 |
| Mean fraction of residues predicted as intrinsically disordered | 0.31 |
| Mean length-normalized TM-Score | 0.90 |
| Mean intra-cluster local Distance Difference Test score | 0.87 |
| Mean intra-cluster sequence similarity (%) | 41.29 |
| Pfam Score | 0.00 |
| Assigned Pfam label(s) | UNKNOWN |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A6A6EDV8 | 51-148 | KKVTAEELRDLRDLIRTRYALDVEIWNLRHVKAFNRQKVHDKMRRADAALAKIERTVLSMDHIEFFEDPADYRKLQDIKVRVLEGGK… |
| A0A0D2GRU6 | 26-123 | QKVSPEELRRVREMMRQRYTLDLEIWGLRNVRNHNREIVEDKMRRADALLACIRATVAAMDGRDYFSRDDDYQKLREIKARVMVGGR… |
| A0A6A5VTM7 | 85-177 | None |
| A0A178EKC7 | 147-246 | None |
| A0A517LBM0 | 137-231 | None |
| A0A6A6X8C3 | 45-143 | None |
| A0A2J6SIX8 | 98-194 | None |
| A0A178DQD1 | 55-150 | None |
| A0A2D5SNH4 | 2-98 | None |
| A0A6A6IRR6 | 77-174 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.