DPCstruct | MC12863
Metacluster Properties and Pfam Annotations
| Number of structural domains | 14 |
|---|---|
| Mean domain length (aa) | 135 ± 10 aa |
| Standard deviation of domain lengths | 10.22 |
| Length coefficient of variation | 0.08 |
| Mean AlphaFold2 pLDDT confidence score | 85.42 |
| Mean fraction of residues predicted as intrinsically disordered | 0.31 |
| Mean length-normalized TM-Score | 0.86 |
| Mean intra-cluster local Distance Difference Test score | 0.91 |
| Mean intra-cluster sequence similarity (%) | 60.87 |
| Pfam Score | 100.00 |
| Assigned Pfam label(s) | PF00771 |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A182MH44 | 124-256 | AFSSFPSVLLVTTLFRLGISIATTRLILLQGDAGHIIETFGNFVVGGNLIVGLVVFLILTIVQFVVITKGAERVAEVAARFSLDAMP… |
| A0A2I7CAH5 | 28-163 | EFAAFPTILLFTTLLRPALNVASTRIILMEGHTGSAAAGRVVAFGHFLVGGNFAIGIVVFVILVIINFMVITKGAGRIAEVGARFVL… |
| A0A3S4F104 | 6-106 | None |
| B7R847 | 39-184 | None |
| A0A090PD40 | 52-189 | None |
| A0A7T9DEX4 | 78-210 | None |
| A0A489FML9 | 57-192 | None |
| A0A0U1HH72 | 65-207 | None |
| A0A2X2DCL2 | 64-201 | None |
| A0A2X2BJI5 | 70-207 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.