DPCstruct | MC12857
Metacluster Properties and Pfam Annotations
| Number of structural domains | 21 |
|---|---|
| Mean domain length (aa) | 230 ± 33 aa |
| Standard deviation of domain lengths | 33.30 |
| Length coefficient of variation | 0.15 |
| Mean AlphaFold2 pLDDT confidence score | 84.73 |
| Mean fraction of residues predicted as intrinsically disordered | 0.26 |
| Mean length-normalized TM-Score | 0.71 |
| Mean intra-cluster local Distance Difference Test score | 0.75 |
| Mean intra-cluster sequence similarity (%) | 39.18 |
| Pfam Score | 100.00 |
| Assigned Pfam label(s) | CL0062 |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A2D6QLA0 | 5-264 | ILLLIGLVLMSLGYLIYSRFIAQRIYRLDPDFRTPAHEFEDGIDFVPTNRFVLWGHHFTSVAGAAPIVGPAIAVIWGWLPAFLWVVM… |
| A4NY46 | 7-221 | CVAVLILGYFIYGKIIEKIFVINPKRQTPAYQVNDGVDYMPMSKTKIWLIQLLNIAGTGPIFGPILGALYGPVAMLWIVIGCIFAGA… |
| A0A379WFF1 | 51-235 | None |
| A0A087A716 | 2-250 | None |
| X8EZ34 | 2-240 | None |
| A0A564VK00 | 105-332 | None |
| A0A377M7B8 | 203-452 | None |
| A0A0B8NSZ8 | 3-216 | None |
| A0A1X7LDW4 | 6-209 | None |
| A0A0N1KGR9 | 6-275 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.