DPCstruct | MC12854
Metacluster Properties and Pfam Annotations
| Number of structural domains | 19 |
|---|---|
| Mean domain length (aa) | 136 ± 11 aa |
| Standard deviation of domain lengths | 10.97 |
| Length coefficient of variation | 0.08 |
| Mean AlphaFold2 pLDDT confidence score | 88.47 |
| Mean fraction of residues predicted as intrinsically disordered | 0.36 |
| Mean length-normalized TM-Score | 0.60 |
| Mean intra-cluster local Distance Difference Test score | 0.74 |
| Mean intra-cluster sequence similarity (%) | 32.16 |
| Pfam Score | 100.00 |
| Assigned Pfam label(s) | CL0317 |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A4NWL4 | 8-137 | LIVAASFASLSLFNSATAELVYKPLEQPVEPAKPDLKIESVNEKFAEKYPNQYNSWRSTANGNGEKIIYADEEDPRLIVLWGGYAFA… |
| A0A3C0NMM7 | 157-283 | AAQVETHSGVTVLHASDWAEKYPEIYESWNMTRESSEIVDYLEQYPMLPTLYEPYGFSFCYGSARGHYYDVVDIEETGRPHALANCW… |
| A0A090VP21 | 2-136 | None |
| A0A378MW62 | 3-136 | None |
| A0A6M8J515 | 10-154 | None |
| A0A069ZIQ6 | 9-146 | None |
| A0A7J5T8F9 | 6-146 | None |
| X1AIQ3 | 13-146 | None |
| A0A090S087 | 5-113 | None |
| A0A7C1H7T3 | 1-165 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.