DPCstruct | MC12853
Metacluster Properties and Pfam Annotations
| Number of structural domains | 40 |
|---|---|
| Mean domain length (aa) | 77 ± 11 aa |
| Standard deviation of domain lengths | 10.95 |
| Length coefficient of variation | 0.14 |
| Mean AlphaFold2 pLDDT confidence score | 78.90 |
| Mean fraction of residues predicted as intrinsically disordered | 0.24 |
| Mean length-normalized TM-Score | 0.77 |
| Mean intra-cluster local Distance Difference Test score | 0.84 |
| Mean intra-cluster sequence similarity (%) | 53.66 |
| Pfam Score | 0.00 |
| Assigned Pfam label(s) | UNKNOWN |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A7R9A613 | 3-74 | LEPFMHQVGGHSSMMCLDNFTVCKPLIERELRFYESLPDVMRPFTAECKGVTEVDCREDEKGYIALTAVPRN |
| Q7T0Q8 | 1-74 | MSPAFGAMEVEHYAKGVLLEPFLHQVGGHSCVLRFNDKTICKPLIQREHLFYETLPAEIRKFTPQYKGTFSLLS |
| A0A286XMX4 | 1-72 | None |
| A0A2P8Y9N9 | 1-62 | None |
| A0A5E4CG61 | 51-156 | None |
| A0A7J7YS22 | 9-64 | None |
| A0A2K5DDJ0 | 54-123 | None |
| A0A2K5DDL0 | 55-138 | None |
| A0A7E4S6M1 | 39-100 | None |
| T0NMY6 | 17-75 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.