DPCstruct | MC12852
Metacluster Properties and Pfam Annotations
| Number of structural domains | 12 |
|---|---|
| Mean domain length (aa) | 427 ± 48 aa |
| Standard deviation of domain lengths | 47.94 |
| Length coefficient of variation | 0.11 |
| Mean AlphaFold2 pLDDT confidence score | 68.17 |
| Mean fraction of residues predicted as intrinsically disordered | 0.57 |
| Mean length-normalized TM-Score | 0.30 |
| Mean intra-cluster local Distance Difference Test score | 0.82 |
| Mean intra-cluster sequence similarity (%) | 28.70 |
| Pfam Score | 81.82 |
| Assigned Pfam label(s) | PF10267- PF15456 |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| Q6NRH6 | 48-508 | NLSQASSMVSSGADGMLGTDAVDGTPDPQRTKAAILQLQQKILKLTEQIKIEQTARDDNVAEYLKLANNADRQQGARIKQVFEKKNQ… |
| L8GBC9 | 19-457 | APEEVDSLRKQCIRLTQRIESTRQNLAVQSKYRDAAINVGKLYSDGGDGKRRSRGSLGLKRNSHTDQSREAEAERAASEQRCEELAQ… |
| A0A0K0D1X8 | 91-477 | None |
| A0A455AGN1 | 80-529 | None |
| A0A1S3P4R3 | 7-395 | None |
| A0A3Q0J6S3 | 147-564 | None |
| A0A2D0RGU0 | 1-433 | None |
| A0A811U8Z2 | 98-455 | None |
| E0VDV9 | 66-571 | None |
| A0A6J8A7A3 | 154-648 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.