DPCstruct | MC1285
Metacluster Properties and Pfam Annotations
| Number of structural domains | 9 |
|---|---|
| Mean domain length (aa) | 119 ± 9 aa |
| Standard deviation of domain lengths | 8.94 |
| Length coefficient of variation | 0.08 |
| Mean AlphaFold2 pLDDT confidence score | 82.71 |
| Mean fraction of residues predicted as intrinsically disordered | 0.24 |
| Mean length-normalized TM-Score | 0.73 |
| Mean intra-cluster local Distance Difference Test score | 0.70 |
| Mean intra-cluster sequence similarity (%) | 29.52 |
| Pfam Score | 0.00 |
| Assigned Pfam label(s) | UNKNOWN |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A1J9RXN5 | 13-131 | AATQLCSAAANTLTALHQFPNGTSVENLAVRSNGAILVTLLYQAQVLEITPGDAATTTTPKLVHAFSNTTRLNGISELGPDTFAVSA… |
| A0A1R0UT29 | 2-120 | ISNTTNTSLAAVANFPPNYFLENIAVRSDGSIPVTALNHSELWYLHTPTSTIPVEPIIIATLDGLTMGIVETEPDIFYVGTLGDPAL… |
| R1GEX3 | 1-123 | None |
| A0A0S7DK61 | 26-129 | None |
| W6Q1A5 | 1-128 | None |
| A0A7U2R1V7 | 325-429 | None |
| A0A4Z1IHM9 | 83-213 | None |
| A0A1Y2VSE3 | 1-116 | None |
| A0A0G2HIQ7 | 16-141 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.