DPCstruct | MC12841
Metacluster Properties and Pfam Annotations
| Number of structural domains | 92 |
|---|---|
| Mean domain length (aa) | 169 ± 32 aa |
| Standard deviation of domain lengths | 31.67 |
| Length coefficient of variation | 0.19 |
| Mean AlphaFold2 pLDDT confidence score | 92.37 |
| Mean fraction of residues predicted as intrinsically disordered | 0.28 |
| Mean length-normalized TM-Score | 0.79 |
| Mean intra-cluster local Distance Difference Test score | 0.72 |
| Mean intra-cluster sequence similarity (%) | 30.11 |
| Pfam Score | 100.00 |
| Assigned Pfam label(s) | CL0318 |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A7V8I8I2 | 72-284 | QVASKVDPTAAAFHPDPALAALGKRVFFDPALSEPRGTSCASCHDPGRAFAPTLSRAALAGPRVPQGSRPGHFSRRNAPSLLYVRYV… |
| A0A2T5NPP2 | 549-726 | APTLDASAQAGFRDLGLLPAAPFPADNPYSAAKVVLGDKLFRDPRLSRNNRIACISCHAPEHGWSDPRPVSQGHIGQLGGRNAMTLL… |
| A0A4D7C9L0 | 2-112 | None |
| A0A2G2M050 | 167-317 | None |
| G3IV16 | 147-286 | None |
| X6Q8B3 | 171-283 | None |
| A0A4R5W1S3 | 406-593 | None |
| A0A3E0NPD8 | 145-358 | None |
| A0A5B9PBR2 | 35-212 | None |
| A0A2H5A2B6 | 31-189 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.