DPCstruct | MC12840
Metacluster Properties and Pfam Annotations
| Number of structural domains | 621 |
|---|---|
| Mean domain length (aa) | 164 ± 25 aa |
| Standard deviation of domain lengths | 24.56 |
| Length coefficient of variation | 0.15 |
| Mean AlphaFold2 pLDDT confidence score | 87.54 |
| Mean fraction of residues predicted as intrinsically disordered | 0.22 |
| Mean length-normalized TM-Score | 0.56 |
| Mean intra-cluster local Distance Difference Test score | 0.52 |
| Mean intra-cluster sequence similarity (%) | 18.70 |
| Pfam Score | 98.77 |
| Assigned Pfam label(s) | CL0301- CL0020- CL0037- CL0010- CL0504 |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A3N2M2S8 | 1-162 | MSIMGETMLDVDQMYLFVKSQNKDFPREIAEAFHRIGSAYGIRGDIALCQSILETGWFRFTGGTAVKPDQHNYCGLGVTRLGKKGHA… |
| A0A1F6WV62 | 12-138 | KAEAIDAYFESRDMPLVGTGMKMVEEAEKNNLDWRLIPAIAVRESTGGKNECKKVPNNPFGWGSCKIGFKSNEEAIEVVAKNLGGNN… |
| A0A348N9N6 | 49-209 | None |
| A0A1C6HVU7 | 2-163 | None |
| A0A7V8ZFV5 | 120-274 | None |
| A0A433REJ1 | 142-294 | None |
| A0A255TUJ9 | 3-136 | None |
| A0A1I1MIA0 | 27-209 | None |
| A0A1Y3TAM3 | 240-402 | None |
| T0E765 | 47-173 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.