DPCstruct | MC1284
Metacluster Properties and Pfam Annotations
| Number of structural domains | 12 |
|---|---|
| Mean domain length (aa) | 153 ± 16 aa |
| Standard deviation of domain lengths | 16.32 |
| Length coefficient of variation | 0.11 |
| Mean AlphaFold2 pLDDT confidence score | 91.97 |
| Mean fraction of residues predicted as intrinsically disordered | 0.39 |
| Mean length-normalized TM-Score | 0.77 |
| Mean intra-cluster local Distance Difference Test score | 0.77 |
| Mean intra-cluster sequence similarity (%) | 49.04 |
| Pfam Score | 0.00 |
| Assigned Pfam label(s) | UNKNOWN |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| D8QAG2 | 1-175 | MSKYQQAEQFMRALVARTGLEPPSATPRRYLWTDAFAVCNLITLHQQGRGENGEYLTLARKLVDQVHHTLGRHRPDDARRGWLSGLS… |
| A0A497LEI7 | 1-157 | MFGSFDLAEKTMNNYARETGILGDCKPRRCLWTDSFAVCNYLGLYRTSKNECYMQLALKLVDQVHFVLGRHREDDPRRGWISGMNEK… |
| A0A6V8QTP1 | 624-797 | None |
| A0A1C7LRW7 | 270-402 | None |
| A0A395RJX1 | 1-171 | None |
| A0A0D2MWG5 | 7-151 | None |
| A0A5N6G776 | 33-194 | None |
| A0A1B8DMP4 | 110-252 | None |
| A0A2I1BS68 | 1-145 | None |
| A0A1D1VYJ4 | 70-205 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.