DPCstruct | MC12838
Metacluster Properties and Pfam Annotations
| Number of structural domains | 11 |
|---|---|
| Mean domain length (aa) | 411 ± 43 aa |
| Standard deviation of domain lengths | 42.95 |
| Length coefficient of variation | 0.10 |
| Mean AlphaFold2 pLDDT confidence score | 84.13 |
| Mean fraction of residues predicted as intrinsically disordered | 0.31 |
| Mean length-normalized TM-Score | 0.51 |
| Mean intra-cluster local Distance Difference Test score | 0.50 |
| Mean intra-cluster sequence similarity (%) | 19.44 |
| Pfam Score | 100.00 |
| Assigned Pfam label(s) | PF09234 |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| B8IHS4 | 4-431 | RLRPLILSRRPREIGLPWVRYPSWFGGKPRLGDRPWPRCATSGRPMYFLAQIDLEEIAGCIGSSALPAAGALAFFIGEAPSGPEAGV… |
| A0A238JHI1 | 23-455 | GTQGTGDGAKRFAGPHSKTAKGTSDPRPAQSGADVAEAFLARAGNESRAKEIPAWALLLHSPFDPPENPQSWIGGVPKAPPGFDWPR… |
| A0A1G7BM09 | 145-519 | None |
| A0A0H0XQL2 | 243-611 | None |
| A0A251WWM5 | 276-745 | None |
| E2CQ99 | 260-664 | None |
| A0A7Y8MPL5 | 1-325 | None |
| I9WKE5 | 75-545 | None |
| A0A1S6FLS5 | 1-384 | None |
| A0A1H4P9H9 | 50-468 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.