DPCstruct | MC12836
Metacluster Properties and Pfam Annotations
| Number of structural domains | 31 |
|---|---|
| Mean domain length (aa) | 187 ± 31 aa |
| Standard deviation of domain lengths | 30.63 |
| Length coefficient of variation | 0.16 |
| Mean AlphaFold2 pLDDT confidence score | 84.05 |
| Mean fraction of residues predicted as intrinsically disordered | 0.18 |
| Mean length-normalized TM-Score | 0.56 |
| Mean intra-cluster local Distance Difference Test score | 0.56 |
| Mean intra-cluster sequence similarity (%) | 14.26 |
| Pfam Score | 0.00 |
| Assigned Pfam label(s) | UNKNOWN |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A098L5V1 | 5-157 | GCFDGFCQVLVPYNIQEFLEYPDNKKKIEILELLKNSLDFVIREKNWDPNPFQEAYERVKELNYINEFIWNKPKLSPNKKYKAEVHC… |
| A0A238J7T6 | 16-209 | STNAPGWAGKFFTRSRTMCNYIYRNFSAPELERIAPSSLLIAMHHTPMPDIYQANGWQVADIPVRLKDAESYLADDMASPEFYYFLA… |
| A0A828AL15 | 2-171 | None |
| A0A4R5GWG1 | 3-163 | None |
| W7ZWK5 | 2-134 | None |
| A0A4R4J7A9 | 170-367 | None |
| A0A7Z1BES8 | 10-207 | None |
| A0A251WH60 | 6-240 | None |
| A0A7L4TP68 | 1-212 | None |
| A0A2S0VRK1 | 6-200 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.