DPCstruct | MC12833
Metacluster Properties and Pfam Annotations
| Number of structural domains | 44 |
|---|---|
| Mean domain length (aa) | 92 ± 10 aa |
| Standard deviation of domain lengths | 10.02 |
| Length coefficient of variation | 0.11 |
| Mean AlphaFold2 pLDDT confidence score | 82.06 |
| Mean fraction of residues predicted as intrinsically disordered | 0.28 |
| Mean length-normalized TM-Score | 0.77 |
| Mean intra-cluster local Distance Difference Test score | 0.85 |
| Mean intra-cluster sequence similarity (%) | 43.15 |
| Pfam Score | 100.00 |
| Assigned Pfam label(s) | PF06884 |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| J0D8Q6 | 1-90 | MDAETKQAAYHTHAYHTAGAAMMSFQPIQKIHQHICAFHPYAHDKTRAVRAHHFCTHFRPDMHQCVIYDGPGDNARLIGIEYIVTDA… |
| A0A7W9A5G9 | 22-104 | TESSVQAPGAEETAKTKALETGAAVMQDRPPIDAVNAYLDGFHFYNGQMKLQMEAHHYCSILNEDVIQCTIYDGNVKDAKLMG |
| A0A066XNE3 | 149-227 | None |
| A0A4S4D7Z2 | 2-97 | None |
| A0A835XXF2 | 78-169 | None |
| A0A3Q0FF89 | 2-99 | None |
| A0A3D8T9F1 | 2-99 | None |
| R1GQV9 | 579-682 | None |
| A0A835RAW6 | 12-102 | None |
| A0A5J5UII2 | 5-82 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.