DPCstruct | MC12832
Metacluster Properties and Pfam Annotations
| Number of structural domains | 12 |
|---|---|
| Mean domain length (aa) | 72 ± 8 aa |
| Standard deviation of domain lengths | 7.72 |
| Length coefficient of variation | 0.11 |
| Mean AlphaFold2 pLDDT confidence score | 95.63 |
| Mean fraction of residues predicted as intrinsically disordered | 0.40 |
| Mean length-normalized TM-Score | 0.96 |
| Mean intra-cluster local Distance Difference Test score | 0.93 |
| Mean intra-cluster sequence similarity (%) | 53.47 |
| Pfam Score | 0.00 |
| Assigned Pfam label(s) | UNKNOWN |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A2V8XAF5 | 404-472 | GHFISPEGEVLTEEAWRKHEFQWLPSAKDYAYVQSLMSGRVTEPGKFANWIAPPVRGINNQPLDFEYVR |
| A0A375IHW0 | 1-61 | MISDAEWRDFRDQWLPTEGDRAFVASLMGRVVEPGKFANWIAPPVMGINRQPVDFEYVRFN |
| A0A2P9GW95 | 248-317 | None |
| A0A1F7LII1 | 87-161 | None |
| A0A1Q8AR79 | 200-270 | None |
| A0A7W0KP82 | 44-130 | None |
| A0A7W0L8V0 | 1-87 | None |
| A0A534R3I2 | 102-175 | None |
| A0A7Y3M6K7 | 16-77 | None |
| A0A2W5ITK4 | 346-415 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.