DPCstruct | MC12830
Metacluster Properties and Pfam Annotations
| Number of structural domains | 13 |
|---|---|
| Mean domain length (aa) | 91 ± 7 aa |
| Standard deviation of domain lengths | 6.91 |
| Length coefficient of variation | 0.08 |
| Mean AlphaFold2 pLDDT confidence score | 82.86 |
| Mean fraction of residues predicted as intrinsically disordered | 0.79 |
| Mean length-normalized TM-Score | 0.59 |
| Mean intra-cluster local Distance Difference Test score | 0.79 |
| Mean intra-cluster sequence similarity (%) | 40.90 |
| Pfam Score | 0.00 |
| Assigned Pfam label(s) | UNKNOWN |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| H8Z8S8 | 1-100 | MSGKRLTAEQVRLYMSSRTQGRTQIQASAKVGISERSGRRIDGAGTRVTERKERHWRTRKDPFAEVWDSDIVPLLEQQPRLDATTLF… |
| A0A375HG08 | 1-98 | MSGTRITDQQVSLYMSKRKQHTQEIAAAKAGISVRSARRIDRDSQLPSQKPRRYWRSRPDPFVEVWDTKVVPMPASEPRLQAITILR… |
| A0A1I6WKP4 | 1-98 | None |
| A0A256G5K9 | 1-88 | None |
| A0A2N3C6H3 | 1-95 | None |
| A0A831NT39 | 1-80 | None |
| A0A2D4VI23 | 1-81 | None |
| A0A2G8R9E2 | 7-103 | None |
| A0A7T1MJH9 | 9-98 | None |
| A0A0Q5YY16 | 2-88 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.