DPCstruct | MC1283
Metacluster Properties and Pfam Annotations
| Number of structural domains | 11 |
|---|---|
| Mean domain length (aa) | 69 ± 3 aa |
| Standard deviation of domain lengths | 2.94 |
| Length coefficient of variation | 0.04 |
| Mean AlphaFold2 pLDDT confidence score | 87.85 |
| Mean fraction of residues predicted as intrinsically disordered | 0.18 |
| Mean length-normalized TM-Score | 0.84 |
| Mean intra-cluster local Distance Difference Test score | 0.81 |
| Mean intra-cluster sequence similarity (%) | 46.51 |
| Pfam Score | 0.00 |
| Assigned Pfam label(s) | UNKNOWN |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A7J3XAV4 | 5-72 | VPVIRLSNGKEIAVTKELIALLNKYVRSEYSLEKLSEDLGLEDWGEAYEFVKRTPAWLMWIQPTYFEK |
| A0A497LD53 | 12-79 | ELVVRVGGKEIVINEETLEILQEYVRTAMPLEELARKLGLRNWMEAFEFVKAVPAWVLWTPPAFWKSQ |
| A0A2R6A5N2 | 3-72 | None |
| A0A510E2I2 | 19-87 | None |
| A0A2R6C9D9 | 59-124 | None |
| A0A7J2IUU8 | 6-77 | None |
| A0A2J6W4S5 | 1-62 | None |
| A0A7J3YUI5 | 8-80 | None |
| A0A833DY58 | 9-79 | None |
| A0A832SDX3 | 17-87 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.