DPCstruct | MC12827
Metacluster Properties and Pfam Annotations
| Number of structural domains | 500 |
|---|---|
| Mean domain length (aa) | 249 ± 52 aa |
| Standard deviation of domain lengths | 51.85 |
| Length coefficient of variation | 0.21 |
| Mean AlphaFold2 pLDDT confidence score | 76.74 |
| Mean fraction of residues predicted as intrinsically disordered | 0.21 |
| Mean length-normalized TM-Score | 0.48 |
| Mean intra-cluster local Distance Difference Test score | 0.57 |
| Mean intra-cluster sequence similarity (%) | 21.51 |
| Pfam Score | 99.52 |
| Assigned Pfam label(s) | CL0023- CL0123- PF20209- PF14214 |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A0C9U7F0 | 16-253 | PSRQVTLSLQVQTNYYFDITDRSFRYHNVFMFVIFNIIQRRTAHLHTYFTVKKSNFESVAKKLCGLSADLIKSVAIHLQREQPYNDL… |
| A0A6G0IR99 | 2-281 | AFPVQFPTGQNTLDEVRGKKLSPSKYFNARLFCVDTRFASDQSYLFFAQFVTETHMATNSMSIQMRKGKPITSDGRKISSKMLQNKQ… |
| A0A1U7Y1G0 | 123-424 | None |
| A0A284RAN5 | 482-803 | None |
| A0A284R8P7 | 699-969 | None |
| A0A0C9UD48 | 6-252 | None |
| A0A1U8FHZ6 | 1-207 | None |
| A0A146HGI6 | 212-478 | None |
| A0A4Y2CXL0 | 78-256 | None |
| A0A6P5G405 | 539-747 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.