DPCstruct | MC12824
Metacluster Properties and Pfam Annotations
| Number of structural domains | 24 |
|---|---|
| Mean domain length (aa) | 161 ± 19 aa |
| Standard deviation of domain lengths | 18.83 |
| Length coefficient of variation | 0.12 |
| Mean AlphaFold2 pLDDT confidence score | 72.01 |
| Mean fraction of residues predicted as intrinsically disordered | 0.31 |
| Mean length-normalized TM-Score | 0.72 |
| Mean intra-cluster local Distance Difference Test score | 0.80 |
| Mean intra-cluster sequence similarity (%) | 42.54 |
| Pfam Score | 100.00 |
| Assigned Pfam label(s) | PF14728 |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A6G0ID59 | 3-163 | LAEAAEENRALLEEAFVRLRSATHLLVLLLSLWQGLTPDQTTILEAMLLPLLQDTPQLGWEESCDAAVSHLLRTCLSRSPKDQATSL… |
| A0A0D2K5T6 | 150-280 | VSLADEEEAAQTATRGAAQALGAGVQLLLQLISAKFGTPDEDVAVLKESLTPTVGHDDAEVGWEEEVEAGLTHLLRSALARNSKEAA… |
| V5H065 | 2-160 | None |
| A0A2I0UDH4 | 32-175 | None |
| A0A6A5FCF7 | 248-405 | None |
| A0A6P4Y676 | 701-867 | None |
| A0A421GQC1 | 513-675 | None |
| A0A437CKL7 | 1033-1227 | None |
| D8UFW5 | 476-633 | None |
| H2YQG8 | 2-124 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.