DPCstruct | MC12821
Metacluster Properties and Pfam Annotations
| Number of structural domains | 930 |
|---|---|
| Mean domain length (aa) | 220 ± 41 aa |
| Standard deviation of domain lengths | 40.94 |
| Length coefficient of variation | 0.19 |
| Mean AlphaFold2 pLDDT confidence score | 80.80 |
| Mean fraction of residues predicted as intrinsically disordered | 0.22 |
| Mean length-normalized TM-Score | 0.65 |
| Mean intra-cluster local Distance Difference Test score | 0.60 |
| Mean intra-cluster sequence similarity (%) | 19.51 |
| Pfam Score | 96.99 |
| Assigned Pfam label(s) | CL0023- PF00786- PF20924- PF00784- CL0184 |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| H0VNY4 | 80-224 | IKKVYCCDLTTLVKAHNTQRPMVVDICIREIEARGLKSEGLYRVSGFTEHIEDVKMAFDRDGEKADISANIYPDINIITGALKLYFR… |
| A0A6G0I4Z0 | 12-244 | EGRSSASTTRVFGVPLEEVTRTHTISGHEVPALVKHIVDYIEEHGHLDLEGLFLVNGNAERVDWLRQRYDSGEEVELEKEADLASAV… |
| F4PN41 | 311-539 | None |
| F4PSG8 | 127-334 | None |
| F4PUS6 | 621-779 | None |
| C4M795 | 697-911 | None |
| F4Q697 | 687-888 | None |
| M2R7W9 | 112-294 | None |
| M2RSN7 | 62-261 | None |
| A0A815VEL6 | 76-265 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.