DPCstruct | MC12819
Metacluster Properties and Pfam Annotations
| Number of structural domains | 24 |
|---|---|
| Mean domain length (aa) | 75 ± 8 aa |
| Standard deviation of domain lengths | 8.36 |
| Length coefficient of variation | 0.11 |
| Mean AlphaFold2 pLDDT confidence score | 85.09 |
| Mean fraction of residues predicted as intrinsically disordered | 0.31 |
| Mean length-normalized TM-Score | 0.76 |
| Mean intra-cluster local Distance Difference Test score | 0.74 |
| Mean intra-cluster sequence similarity (%) | 29.04 |
| Pfam Score | 0.00 |
| Assigned Pfam label(s) | UNKNOWN |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A4P5ZBS6 | 62-140 | IPAEQVFDRRGKELYENVIRAQVETPENIGKIISINVETGEYEIGEDLVVTSGKLQAKQANAIIWAERIGFDAVYAVGG |
| A0A7X4A0C2 | 7-88 | TMSPEEIADAAERLYEDKFRSHYESSHKGEFLAIDVFNEDAYFGKYPEDAMEEAERAVPEGTFFLVRIGEPAAFDVGYTCEQ |
| A0A510PQR8 | 1-58 | None |
| A0A252E0B2 | 51-126 | None |
| A0A6G8QCW1 | 1-85 | None |
| A0A433UP50 | 43-121 | None |
| A0A251WEF8 | 1-58 | None |
| A0A537LYQ5 | 63-141 | None |
| A0A2H6L9S6 | 7-83 | None |
| B0JRX2 | 4-84 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.