DPCstruct | MC12817
Metacluster Properties and Pfam Annotations
| Number of structural domains | 9 |
|---|---|
| Mean domain length (aa) | 109 ± 8 aa |
| Standard deviation of domain lengths | 7.91 |
| Length coefficient of variation | 0.07 |
| Mean AlphaFold2 pLDDT confidence score | 94.64 |
| Mean fraction of residues predicted as intrinsically disordered | 0.15 |
| Mean length-normalized TM-Score | 0.93 |
| Mean intra-cluster local Distance Difference Test score | 0.89 |
| Mean intra-cluster sequence similarity (%) | 46.13 |
| Pfam Score | 100.00 |
| Assigned Pfam label(s) | CL0020 |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A2R8CIW3 | 1-98 | MFLQFNDNTRDRGLFYQALTAVLEIAIDDELEFEDYYKNLSRMFGEEKILAAVGSVNGDVRFYGLTETGMQLEGIDRHQRLITSYQK… |
| A0A4U9HRJ6 | 300-416 | MLALAGGDLEQALIWTEWTIEFNASVFSAERANYYRCLQTLLLLAQEEDREPLQYLNAFTRMYGADAVENASAALSGEAPFYGLQAV… |
| A0A848HQ63 | 620-731 | None |
| A0A485C9Q9 | 1-117 | None |
| A0A831R8U5 | 401-509 | None |
| A0A4U9HCF7 | 65-180 | None |
| A0A7V2SUZ4 | 134-242 | None |
| D4ZJS6 | 476-584 | None |
| A0A376KX54 | 2-94 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.