DPCstruct | MC12811
Metacluster Properties and Pfam Annotations
| Number of structural domains | 9 |
|---|---|
| Mean domain length (aa) | 143 ± 20 aa |
| Standard deviation of domain lengths | 20.45 |
| Length coefficient of variation | 0.14 |
| Mean AlphaFold2 pLDDT confidence score | 77.18 |
| Mean fraction of residues predicted as intrinsically disordered | 0.55 |
| Mean length-normalized TM-Score | 0.60 |
| Mean intra-cluster local Distance Difference Test score | 0.77 |
| Mean intra-cluster sequence similarity (%) | 29.60 |
| Pfam Score | 0.00 |
| Assigned Pfam label(s) | UNKNOWN |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A7R9WWZ3 | 1-106 | SATTTTTATALAPIPSIEVAPGVMEPLRPADEMYRAMTTGNVMPTSCFACNLELMSLDDAKYILCPDCRVVSPIRMEYDFGQKGVAL… |
| A0A7S3P6B4 | 19-169 | NDNFQDPLDKDKPSLGMGGGGSGVTKPGVQFCSSHDAVSAKIAAFDGKGGPAAHQPQIEIAPGIMARLRGAKETWECVENDFYLPVT… |
| B7FVB7 | 167-290 | None |
| B7GBB6 | 255-428 | None |
| B7FW11 | 69-208 | None |
| A0A7S2VEY0 | 112-242 | None |
| A0A7S2YHR0 | 507-674 | None |
| A0A7S2YEQ3 | 392-526 | None |
| A0A7S2YLJ3 | 23-178 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.