DPCstruct | MC12810
Metacluster Properties and Pfam Annotations
| Number of structural domains | 26 |
|---|---|
| Mean domain length (aa) | 117 ± 18 aa |
| Standard deviation of domain lengths | 17.75 |
| Length coefficient of variation | 0.15 |
| Mean AlphaFold2 pLDDT confidence score | 72.17 |
| Mean fraction of residues predicted as intrinsically disordered | 0.41 |
| Mean length-normalized TM-Score | 0.52 |
| Mean intra-cluster local Distance Difference Test score | 0.77 |
| Mean intra-cluster sequence similarity (%) | 25.40 |
| Pfam Score | 100.00 |
| Assigned Pfam label(s) | PF01632 |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A146IMA2 | 1-93 | MFLTSLRPLTTWARAFSTTSVLEAGYKLKSHSGAKKRWRSSPGLQSFKRGRAGRAHLNTSKAPARLNRLGNTAYSTPAQTHKLRKVL… |
| A0A7S3P505 | 1-119 | MFGFLARQSRTLLGGRFPSVPTIKFPPRVVADGLWGTLWQQQQQLLQQQTLLTIRSKHTNKTIKGVAKRFRARGNGTLKRAKAGRQH… |
| A0A835J3U4 | 30-140 | None |
| A0A061QQT8 | 1-149 | None |
| A0A5J4YL85 | 3-109 | None |
| A0A2G3BJ60 | 37-143 | None |
| A0A1R3HF44 | 359-490 | None |
| F0VCJ1 | 279-417 | None |
| A0A1Y1YIX1 | 639-728 | None |
| W7TVE4 | 21-113 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.