DPCstruct | MC12809
Metacluster Properties and Pfam Annotations
| Number of structural domains | 37 |
|---|---|
| Mean domain length (aa) | 84 ± 17 aa |
| Standard deviation of domain lengths | 16.66 |
| Length coefficient of variation | 0.20 |
| Mean AlphaFold2 pLDDT confidence score | 89.16 |
| Mean fraction of residues predicted as intrinsically disordered | 0.19 |
| Mean length-normalized TM-Score | 0.75 |
| Mean intra-cluster local Distance Difference Test score | 0.77 |
| Mean intra-cluster sequence similarity (%) | 27.99 |
| Pfam Score | 100.00 |
| Assigned Pfam label(s) | PF01430 |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A844EGL9 | 2-66 | LHFLQTIPVEFSCNCSKFRFGRDLEGIPVPQLETMLKEDHGIDVTCNFCGKQYHYNEEELTKIIK |
| A0A7S3LC74 | 13-91 | TPVEIAETLLDGLDMQPLQQIFPKLVCECTEDRLFRALRLLPREEVEEILEKEEEVSARCQFCGKEYRMGAAELRTRLD |
| A0A377D8T7 | 1-58 | None |
| Q9PCR5 | 23-109 | None |
| A0A7C6P630 | 9-80 | None |
| A0A1Z8QHK5 | 76-176 | None |
| A0A7C3D2S2 | 100-178 | None |
| R1BSN7 | 87-178 | None |
| G6EM18 | 5-73 | None |
| A0A1V5WSC8 | 11-89 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.