DPCstruct | MC12803
Metacluster Properties and Pfam Annotations
| Number of structural domains | 6 |
|---|---|
| Mean domain length (aa) | 364 ± 30 aa |
| Standard deviation of domain lengths | 29.56 |
| Length coefficient of variation | 0.08 |
| Mean AlphaFold2 pLDDT confidence score | 73.72 |
| Mean fraction of residues predicted as intrinsically disordered | 0.35 |
| Mean length-normalized TM-Score | 0.57 |
| Mean intra-cluster local Distance Difference Test score | 0.58 |
| Mean intra-cluster sequence similarity (%) | 29.54 |
| Pfam Score | 0.00 |
| Assigned Pfam label(s) | UNKNOWN |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A1E7F141 | 13-322 | SSDEEYYSPYFEKYDADGDSYSLSWRYLGAFIDEDDEYYPRKVLWAAYYDPNYSGFQIGEYSYYDWENSQWDNSTCVEGATCSKMDC… |
| A0A7S4K2E7 | 14-377 | AGGVDDDDGRRRRLSGSDDENNCGRKVLWAAYHDKRYKGGTIGEYAIYDLTLDPNGGEAGATYGDGNDGIGGYDGSTCQTKRCARLD… |
| K0SCD5 | 30-424 | None |
| A0A1E7FUK3 | 25-402 | None |
| A0A7S1G2Q6 | 42-384 | None |
| A0A7S2PRL8 | 21-411 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.