DPCstruct | MC12800
Metacluster Properties and Pfam Annotations
| Number of structural domains | 20 |
|---|---|
| Mean domain length (aa) | 106 ± 13 aa |
| Standard deviation of domain lengths | 12.89 |
| Length coefficient of variation | 0.12 |
| Mean AlphaFold2 pLDDT confidence score | 88.38 |
| Mean fraction of residues predicted as intrinsically disordered | 0.18 |
| Mean length-normalized TM-Score | 0.78 |
| Mean intra-cluster local Distance Difference Test score | 0.74 |
| Mean intra-cluster sequence similarity (%) | 19.96 |
| Pfam Score | 0.00 |
| Assigned Pfam label(s) | UNKNOWN |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A098M3D0 | 6-116 | LSLVRSYLLLTFIHKVFERDCRVIGKSGLFKTPQLYMELVSTGAKKTSLMLKEVKRELELHDLRIVTILQDVQGVVARYHCRECPGE… |
| A0A231R1S3 | 2-103 | LTMCDKSLQEIRRTPNLFKQQLGEFIQMVMDKISREMFALRRELRGRNIKVYEDEMLDGIIYHRYCCRGYEDRFAIVREALRTEIGV… |
| A0A2R9SN35 | 2-105 | None |
| A0A7Y6BU69 | 98-209 | None |
| T5HI11 | 5-116 | None |
| W4B288 | 77-180 | None |
| A0A6F9E0D8 | 1-85 | None |
| A0A3S0WCI4 | 8-126 | None |
| A0A024QHW6 | 2-107 | None |
| A0A559J4D3 | 2-110 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.