DPCstruct | MC1280
Metacluster Properties and Pfam Annotations
| Number of structural domains | 15 |
|---|---|
| Mean domain length (aa) | 105 ± 8 aa |
| Standard deviation of domain lengths | 7.75 |
| Length coefficient of variation | 0.07 |
| Mean AlphaFold2 pLDDT confidence score | 90.76 |
| Mean fraction of residues predicted as intrinsically disordered | 0.18 |
| Mean length-normalized TM-Score | 0.79 |
| Mean intra-cluster local Distance Difference Test score | 0.85 |
| Mean intra-cluster sequence similarity (%) | 36.96 |
| Pfam Score | 0.00 |
| Assigned Pfam label(s) | UNKNOWN |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A3R9PT88 | 19-124 | NFLIKERLRHELERLKRATGLGFELDVVWMPQDNKLSGEVKGKKIYVYEEDEEKAVETLYHEFFDYAVSRAIEPYRSVLNSLISCLN… |
| A0A497KYT7 | 13-116 | VQTLLEEELRRLKEKSGLGYGLEVTWMPDGPKDRAGEVKRNVILVYEKEPEAALKTLRHEFVDWLVSQVTRAHKQLVNKLLELLELQ… |
| A0A7J2TBZ5 | 78-177 | None |
| A0A7V4KBS6 | 3-99 | None |
| A0A087RUJ9 | 1-115 | None |
| A0A7J3P1G4 | 2-103 | None |
| A0A7J3DRV0 | 20-131 | None |
| A0A062V3V6 | 144-256 | None |
| A0A832GS91 | 6-108 | None |
| A0A7C4DDA7 | 1-85 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.