DPCstruct | MC128
Metacluster Properties and Pfam Annotations
| Number of structural domains | 18 |
|---|---|
| Mean domain length (aa) | 262 ± 38 aa |
| Standard deviation of domain lengths | 38.07 |
| Length coefficient of variation | 0.15 |
| Mean AlphaFold2 pLDDT confidence score | 86.64 |
| Mean fraction of residues predicted as intrinsically disordered | 0.26 |
| Mean length-normalized TM-Score | 0.73 |
| Mean intra-cluster local Distance Difference Test score | 0.71 |
| Mean intra-cluster sequence similarity (%) | 27.64 |
| Pfam Score | 100.00 |
| Assigned Pfam label(s) | CL0080 |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A538I7V9 | 28-231 | YVEPWPRRVRAFSRDRAVVDSERTVLVYESGRLPRYAFPAEDVAIDAEPEPEVDGYVTVPWSSADRWLEEEQEVIVHPHDPYHRIEV… |
| A0A364L2F3 | 9-235 | GYSEDVWRRVRVLFNGQFIVDENVPKLVWEHPYFPVYYFQFSAIKPEYLTNQQAGDDADVYDLTVDGKTSSSAIKVIKQGDLKDHIK… |
| S0EP43 | 713-968 | None |
| A0A559TS31 | 7-213 | None |
| A0A2E0RY66 | 224-443 | None |
| A0A6G1M813 | 85-377 | None |
| A0A081I223 | 30-263 | None |
| M3BTB0 | 39-386 | None |
| A0A162JMK1 | 482-769 | None |
| A0A438MTN6 | 4-263 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.