DPCstruct | MC12799
Metacluster Properties and Pfam Annotations
| Number of structural domains | 16 |
|---|---|
| Mean domain length (aa) | 88 ± 5 aa |
| Standard deviation of domain lengths | 5.00 |
| Length coefficient of variation | 0.06 |
| Mean AlphaFold2 pLDDT confidence score | 89.02 |
| Mean fraction of residues predicted as intrinsically disordered | 0.24 |
| Mean length-normalized TM-Score | 0.87 |
| Mean intra-cluster local Distance Difference Test score | 0.85 |
| Mean intra-cluster sequence similarity (%) | 49.75 |
| Pfam Score | 100.00 |
| Assigned Pfam label(s) | CL0237 |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A6J8EQJ8 | 312-398 | KFIPKARPDIRWKHEDGSVMMFDYLIKKWRLMKEFKKYGLRDFDIIFIKEQIAGPLKKIEEGWPYRGRDEKKGFLYEIVSNNKNGID |
| A0A669EC71 | 1-98 | MLVFVFLQHEDASILMFDHLVDDNNLKPVMNEYGLITEGDNENDLVFIKEMIKGSLKNNLPQNEQLYRGRNNEKSFLYEIVANKQNG… |
| A0A4Z2G941 | 220-304 | None |
| A0A3P4S0J6 | 6-95 | None |
| A0A3Q3FHY8 | 174-254 | None |
| H0VBB6 | 220-308 | None |
| A0A498L4U5 | 22-109 | None |
| C1BSY8 | 204-289 | None |
| A0A7J6DIY2 | 1-88 | None |
| A0A7T8GPC2 | 1-95 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.