DPCstruct | MC12795
Metacluster Properties and Pfam Annotations
| Number of structural domains | 4 |
|---|---|
| Mean domain length (aa) | 162 ± 14 aa |
| Standard deviation of domain lengths | 13.66 |
| Length coefficient of variation | 0.08 |
| Mean AlphaFold2 pLDDT confidence score | 80.73 |
| Mean fraction of residues predicted as intrinsically disordered | 0.18 |
| Mean length-normalized TM-Score | 0.74 |
| Mean intra-cluster local Distance Difference Test score | 0.83 |
| Mean intra-cluster sequence similarity (%) | 42.98 |
| Pfam Score | 88.89 |
| Assigned Pfam label(s) | CL0539- CL0010 |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A453J622 | 59-228 | QPLIRARGVSYCKNLLSPRFEHSEAREGDFSENVDKTYYVYLPPELCLVHPLPGSLIRGAQRLPSIMRRVESMLLAVQLKETIDYPV… |
| A0A5B6WZI7 | 197-361 | HNLLVDFNDEDFSAQALQASSVNEKSWNNIHMPPELLLVLDVPVYVLKAFYLLPSLMHRLESLMLASQLREEIDFRSSNFDILSSLI… |
| A0A0E0BBX5 | 1040-1178 | None |
| A0A2H5PT54 | 1-174 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.