DPCstruct | MC12792
Metacluster Properties and Pfam Annotations
| Number of structural domains | 13 |
|---|---|
| Mean domain length (aa) | 214 ± 28 aa |
| Standard deviation of domain lengths | 28.25 |
| Length coefficient of variation | 0.13 |
| Mean AlphaFold2 pLDDT confidence score | 84.74 |
| Mean fraction of residues predicted as intrinsically disordered | 0.21 |
| Mean length-normalized TM-Score | 0.85 |
| Mean intra-cluster local Distance Difference Test score | 0.79 |
| Mean intra-cluster sequence similarity (%) | 29.39 |
| Pfam Score | 100.00 |
| Assigned Pfam label(s) | CL0050 |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A7R7X2H5 | 396-595 | VQSITIEPTGKSIVVKATIERAGEPIAFVTSSFFMRGTYTDYASCFERITEPETLLEVSTSVDEELLRSRPWLQLNEPGTPIVGKTL… |
| A0A4S3J727 | 1-155 | MEAMEVAVTIARDGEAIVQVATAFLFPRPHTNDSIEFEDRQEDPVQIHLNSPIDLEQFQGKELVFVLTSHSTFQDKSSNREMRTTGH… |
| W6PSW7 | 125-327 | None |
| A0A0B4G734 | 458-698 | None |
| A0A317SQH2 | 122-338 | None |
| A0A2T6ZSF7 | 542-728 | None |
| A0A1Y1W3D7 | 109-335 | None |
| A0A4P9VYQ6 | 382-625 | None |
| S8E1J3 | 512-686 | None |
| A0A0P1B9Y4 | 501-756 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.