DPCstruct | MC12790
Metacluster Properties and Pfam Annotations
| Number of structural domains | 12 |
|---|---|
| Mean domain length (aa) | 162 ± 10 aa |
| Standard deviation of domain lengths | 9.90 |
| Length coefficient of variation | 0.06 |
| Mean AlphaFold2 pLDDT confidence score | 75.21 |
| Mean fraction of residues predicted as intrinsically disordered | 0.31 |
| Mean length-normalized TM-Score | 0.69 |
| Mean intra-cluster local Distance Difference Test score | 0.76 |
| Mean intra-cluster sequence similarity (%) | 39.57 |
| Pfam Score | 100.00 |
| Assigned Pfam label(s) | CL0062 |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A4S3J3X4 | 2-157 | KTVYQEVFQELLHFPIITTKKGRILWLILGCVYWIVAFIVATAVPNLNGISSLVGAFLILNFTHTFPVFLYIRFRCQMGAALPGEGF… |
| A0A1Y2FWF3 | 80-250 | TNLAGTAFFGNIGAKLLYVNLIDRFDGPLLISKTGRAVFYAFATLFWALSFVIVAIVPQAGVVIRFTTTLLILPFSVAIPVAIHLGL… |
| A0A0A1V3L4 | 52-211 | None |
| A0A1Z5TAV6 | 466-618 | None |
| A0A3M6WFY4 | 463-626 | None |
| A0A1J8Q3D7 | 140-287 | None |
| A0A3M6WXL9 | 388-549 | None |
| A0A3M6ZLF8 | 163-324 | None |
| A0A137Q1J2 | 990-1178 | None |
| A0A425BJ47 | 3-165 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.