DPCstruct | MC1279
Metacluster Properties and Pfam Annotations
| Number of structural domains | 11 |
|---|---|
| Mean domain length (aa) | 124 ± 18 aa |
| Standard deviation of domain lengths | 17.63 |
| Length coefficient of variation | 0.14 |
| Mean AlphaFold2 pLDDT confidence score | 91.11 |
| Mean fraction of residues predicted as intrinsically disordered | 0.20 |
| Mean length-normalized TM-Score | 0.81 |
| Mean intra-cluster local Distance Difference Test score | 0.79 |
| Mean intra-cluster sequence similarity (%) | 36.28 |
| Pfam Score | 0.00 |
| Assigned Pfam label(s) | UNKNOWN |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A564Q8D9 | 1-121 | MARAPITAVMKARHFAEKARKGELQRTFVDNYGNEPEQFFICMDTLKRRYGEDYAKIPYGAIGFYTYLVDKMGTGLKQLMAGARKFK… |
| A0A7C1ALQ6 | 266-400 | MGRALMIPGFLGSNIEGVLKPENKQKVNGNWDKLPPSVSQFGNTPEEIFACYYEVEKKVGKEEMKNIPFGAIALYTLADKLSAGLQQ… |
| A0A645AI36 | 21-139 | None |
| A0A1W1V7T4 | 1-116 | None |
| A0A7C6SB94 | 284-385 | None |
| A0A0F9KV68 | 432-552 | None |
| A0A7C4LFH1 | 319-440 | None |
| A0A7K4H4C3 | 29-182 | None |
| A0A0F9MDJ2 | 391-545 | None |
| A0A7V0V2L8 | 200-324 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.