DPCstruct | MC12789
Metacluster Properties and Pfam Annotations
| Number of structural domains | 15 |
|---|---|
| Mean domain length (aa) | 107 ± 8 aa |
| Standard deviation of domain lengths | 8.11 |
| Length coefficient of variation | 0.08 |
| Mean AlphaFold2 pLDDT confidence score | 79.70 |
| Mean fraction of residues predicted as intrinsically disordered | 0.21 |
| Mean length-normalized TM-Score | 0.81 |
| Mean intra-cluster local Distance Difference Test score | 0.81 |
| Mean intra-cluster sequence similarity (%) | 36.38 |
| Pfam Score | 0.00 |
| Assigned Pfam label(s) | UNKNOWN |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A7U2R0V3 | 9-107 | ENLTRRVEIFARIATANSLNYICPQCFCGYSEQRLLYRHFDKEKQNCRIHAALGERKSDHLAFVMNYKMALRTLIDAKDIPPNPHCF… |
| A0A4S3J3F3 | 2-96 | ASVQRQCDTLKEIIHKSSIRFIFPQCLQGFPRSDLLYRHFRAEEDEVHAGLSVRDTDFKRFLSCYQKALRASIPAEKLPFDSKRFDV… |
| A0A1L9U1S1 | 2-116 | None |
| A0A319EE42 | 2-107 | None |
| B0XZL1 | 39-137 | None |
| A0A401KY88 | 374-484 | None |
| A0A395HAB2 | 14-115 | None |
| A0A1L9U3V1 | 109-229 | None |
| A0A7R7W5E9 | 8-116 | None |
| A0A7R8A0N0 | 6-104 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.