DPCstruct | MC12786
Metacluster Properties and Pfam Annotations
| Number of structural domains | 18 |
|---|---|
| Mean domain length (aa) | 62 ± 6 aa |
| Standard deviation of domain lengths | 6.07 |
| Length coefficient of variation | 0.10 |
| Mean AlphaFold2 pLDDT confidence score | 83.74 |
| Mean fraction of residues predicted as intrinsically disordered | 0.16 |
| Mean length-normalized TM-Score | 0.91 |
| Mean intra-cluster local Distance Difference Test score | 0.87 |
| Mean intra-cluster sequence similarity (%) | 57.92 |
| Pfam Score | 100.00 |
| Assigned Pfam label(s) | CL0113 |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A0R3RB86 | 1-53 | MFITIIHPDLGIGGAERLVVDAAIAMKQNGHRVQFVTNHFNPKHSFLETKEFG |
| A0A4S3IZA4 | 4-78 | LQRSNVIIIHPDLGIGGAERLIIDVALALQARGHRVTIYTSHRDKTHCFEEARDGTLDVRVRGNTVFPAHVVERA |
| A9UZ94 | 6-67 | None |
| A0A507EK29 | 2-61 | None |
| A0A232LU49 | 2-69 | None |
| A0A183QMX0 | 1-52 | None |
| A0A168BAQ2 | 72-127 | None |
| V5BPX6 | 57-127 | None |
| A0A7R8H1D5 | 5-61 | None |
| A0A0X3PHK0 | 1-59 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.