DPCstruct | MC12785
Metacluster Properties and Pfam Annotations
| Number of structural domains | 11 |
|---|---|
| Mean domain length (aa) | 111 ± 6 aa |
| Standard deviation of domain lengths | 6.07 |
| Length coefficient of variation | 0.05 |
| Mean AlphaFold2 pLDDT confidence score | 91.69 |
| Mean fraction of residues predicted as intrinsically disordered | 0.26 |
| Mean length-normalized TM-Score | 0.90 |
| Mean intra-cluster local Distance Difference Test score | 0.83 |
| Mean intra-cluster sequence similarity (%) | 46.06 |
| Pfam Score | 100.00 |
| Assigned Pfam label(s) | CL0727 |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A6V8R5W6 | 135-252 | HAWNHYGMAAWTGISGDRYYCFDQGGPDFTKVSAEWIKDNIQLGPLGSAYPNFMFIPEGDTPTFLYLIQNGLGVPEQPSYGSWGGRY… |
| A0A4S3IY88 | 1-103 | MSSWQGILHPISDGDISKLSPEWLQTHIQKGPLGDVYPIPIHIAEGDTPTLLYHVQSGLGVHERPDYGSWDGHYRVINGGSTHYAYV… |
| A0A6A5Z6N2 | 67-169 | None |
| A0A166TY17 | 96-208 | None |
| A0A0D2FIS1 | 184-291 | None |
| A0A423VEK3 | 231-345 | None |
| A0A430M9L9 | 55-155 | None |
| A0A4U9F1E6 | 680-795 | None |
| B8MBH2 | 120-235 | None |
| A0A5N6UY33 | 354-471 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.