DPCstruct | MC12784
Metacluster Properties and Pfam Annotations
| Number of structural domains | 145 |
|---|---|
| Mean domain length (aa) | 319 ± 73 aa |
| Standard deviation of domain lengths | 72.95 |
| Length coefficient of variation | 0.23 |
| Mean AlphaFold2 pLDDT confidence score | 82.04 |
| Mean fraction of residues predicted as intrinsically disordered | 0.25 |
| Mean length-normalized TM-Score | 0.53 |
| Mean intra-cluster local Distance Difference Test score | 0.59 |
| Mean intra-cluster sequence similarity (%) | 20.57 |
| Pfam Score | 75.42 |
| Assigned Pfam label(s) | PF13864- PF01124- CL0260- PF00621- CL0198 |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A6A4T3L6 | 142-321 | QRRITLDNHNTIITGALSLLAENAELSEEDGRGVAFRRAAAVLKALPEPVTCMTQLRGLPCLGEHSLRVIKDILENGESNEVESMKQ… |
| A0A0M0JTJ3 | 682-1008 | EDEDDDMDALGPAVALAQGLSTKEFIIAEIKKLGAAYKSGAGGSGQHGSWARNQHYLQAPGAIEHHLREPVSLKTLQALRRVHGIGE… |
| A0A553NJN7 | 94-352 | None |
| A0A1I8IBB6 | 81-292 | None |
| A0A6P6QS51 | 57-304 | None |
| A0A5J4YMS2 | 421-769 | None |
| B8JIE9 | 179-564 | None |
| A0A7S4PPF1 | 212-600 | None |
| A0A1F8P1M2 | 3-194 | None |
| A0A069RG09 | 4-242 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.