DPCstruct | MC12783
Metacluster Properties and Pfam Annotations
| Number of structural domains | 19 |
|---|---|
| Mean domain length (aa) | 183 ± 21 aa |
| Standard deviation of domain lengths | 20.85 |
| Length coefficient of variation | 0.11 |
| Mean AlphaFold2 pLDDT confidence score | 74.26 |
| Mean fraction of residues predicted as intrinsically disordered | 0.21 |
| Mean length-normalized TM-Score | 0.64 |
| Mean intra-cluster local Distance Difference Test score | 0.65 |
| Mean intra-cluster sequence similarity (%) | 27.31 |
| Pfam Score | 0.00 |
| Assigned Pfam label(s) | UNKNOWN |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A0M0JT96 | 3-183 | RAQKGAGSDVFEIKDFSVSTPWEAFVVALEEAVRAWLDGRVWLATKEHPQLLPCIEHELEHEGGQRYVLSLHGNPHVARTTSRTGGT… |
| A0A016RVT4 | 298-476 | EVFEIDDFTVITEFERFVVAIDALVQEWGLIGTRPRKKYPKGALRVCAWQSKSSTVNFGESNKLKVTYYYPDLPSDVIEEVPCSEND… |
| A0A5E4BCL5 | 1-199 | None |
| A0A816I368 | 51-208 | None |
| A0A183U208 | 12-198 | None |
| A0A453IA87 | 1-171 | None |
| A0A7J6X9G7 | 1-150 | None |
| A0A182JTW7 | 316-514 | None |
| A0A3P7DGJ7 | 235-398 | None |
| A0A182F603 | 3-196 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.