DPCstruct | MC12782
Metacluster Properties and Pfam Annotations
| Number of structural domains | 18 |
|---|---|
| Mean domain length (aa) | 481 ± 59 aa |
| Standard deviation of domain lengths | 58.69 |
| Length coefficient of variation | 0.12 |
| Mean AlphaFold2 pLDDT confidence score | 86.82 |
| Mean fraction of residues predicted as intrinsically disordered | 0.23 |
| Mean length-normalized TM-Score | 0.80 |
| Mean intra-cluster local Distance Difference Test score | 0.78 |
| Mean intra-cluster sequence similarity (%) | 42.67 |
| Pfam Score | 0.00 |
| Assigned Pfam label(s) | CL0029- PF03497 |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A0M0JT72 | 2-472 | RMLFDGSACGKALNIKGKSARSGILSGFVPFLQIDNEADKGKVGTSPSDARSRVFFRTKAARDSVRARLEPILAEIEARATKATQLM… |
| A0A812IA69 | 45-552 | PARLDPRHQLAAFLGRGDEQGPDGFLKQKGLLPGREETNWFAVFRPTSADAISKMMDGQGTGKGLNVKGKSAKTGCLSGFVPVLQIS… |
| A0A1E7F7Y0 | 3-423 | None |
| A0A812HDJ4 | 248-703 | None |
| A0A7S3AWP1 | 2-387 | None |
| A0A812ZBV5 | 709-1148 | None |
| A0A7S3FAC1 | 51-566 | None |
| A0A7S2XR94 | 60-616 | None |
| A0A812WFJ0 | 98-545 | None |
| A0A7S1VXZ0 | 162-704 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.