DPCstruct | MC12781
Metacluster Properties and Pfam Annotations
| Number of structural domains | 163 |
|---|---|
| Mean domain length (aa) | 295 ± 71 aa |
| Standard deviation of domain lengths | 70.98 |
| Length coefficient of variation | 0.24 |
| Mean AlphaFold2 pLDDT confidence score | 75.00 |
| Mean fraction of residues predicted as intrinsically disordered | 0.28 |
| Mean length-normalized TM-Score | 0.60 |
| Mean intra-cluster local Distance Difference Test score | 0.60 |
| Mean intra-cluster sequence similarity (%) | 20.13 |
| Pfam Score | 95.97 |
| Assigned Pfam label(s) | CL0235- PF03798- CL0063- CL0184 |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A538L5H6 | 5-238 | LVQNRLWLIGTAAAFAGFGFQAAALHGGRLSVVQPVLVTELIFVLVLRWLWLRQRVRPAAWGSAALTCISLAVFLVAAEPRGGNSSP… |
| A0A0M0JRU0 | 16-293 | RWRWMIGFFNLAIFATVLNLISFGLLPLALISPFAGMTMVFSILLAATGLLHASERISYEQCRGCAIVLTGLTVVSLYGPHATGQGA… |
| A0A7J6LCB6 | 536-855 | None |
| A0A540K437 | 1-176 | None |
| A0A0D2MYC7 | 4-169 | None |
| A0A6G1EKX0 | 361-640 | None |
| A0A7C9DRW7 | 9-171 | None |
| A0A6P6CC13 | 29-308 | None |
| A0A6J1W9F2 | 2-197 | None |
| A0A7S1VNJ1 | 4-394 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.