DPCstruct | MC12780
Metacluster Properties and Pfam Annotations
| Number of structural domains | 36 |
|---|---|
| Mean domain length (aa) | 108 ± 13 aa |
| Standard deviation of domain lengths | 13.31 |
| Length coefficient of variation | 0.12 |
| Mean AlphaFold2 pLDDT confidence score | 77.37 |
| Mean fraction of residues predicted as intrinsically disordered | 0.33 |
| Mean length-normalized TM-Score | 0.40 |
| Mean intra-cluster local Distance Difference Test score | 0.62 |
| Mean intra-cluster sequence similarity (%) | 25.17 |
| Pfam Score | 100.00 |
| Assigned Pfam label(s) | PF18974 |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| H5WP27 | 12-119 | LRVMKKLAPNARGAKGVSAAYGGKLVCVRHRLDATGMKRLITVELIVAEKAIARRPGPTVDLSLRPQEKELQAKLKAAGAKWHESDA… |
| A0A0M0JR81 | 113-215 | CPRKIVAGVRNRNVPLMCPYGEKDDVKQLGGRWNNEERQWYVPAGLELAPFSRWNAEAFTYLRFAWRDEELRSRIKAQGAEFDGKTK… |
| A0A7S0XLN9 | 74-182 | None |
| A0A533QZM6 | 188-308 | None |
| E1IET6 | 3-93 | None |
| A0A7S3ZV34 | 500-593 | None |
| A0A5E7QCU6 | 30-152 | None |
| A0A7S3LNI9 | 53-148 | None |
| A0A4R6DUH9 | 730-844 | None |
| A0A2A4SQK9 | 1-104 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.