DPCstruct | MC1278
Metacluster Properties and Pfam Annotations
| Number of structural domains | 20 |
|---|---|
| Mean domain length (aa) | 102 ± 11 aa |
| Standard deviation of domain lengths | 10.50 |
| Length coefficient of variation | 0.10 |
| Mean AlphaFold2 pLDDT confidence score | 93.12 |
| Mean fraction of residues predicted as intrinsically disordered | 0.20 |
| Mean length-normalized TM-Score | 0.82 |
| Mean intra-cluster local Distance Difference Test score | 0.75 |
| Mean intra-cluster sequence similarity (%) | 24.76 |
| Pfam Score | 0.00 |
| Assigned Pfam label(s) | UNKNOWN |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A832G373 | 7-111 | IGGREKMKDNAINTAKLLNRIQPKFTGVLTYMPVPNTTLYFKIERGEFELPNAIENLQELRMLVENLEAKTIFRCNHASNYLPMRGN… |
| A0A564Q854 | 13-123 | HAKNTASVLNEIDPDFVRSRPYTPNPLTPLFEEWTSGNFELLSPHGYLREIKMMVEDLKFNGRLCFDHAMNFWRGRDGRPLFRMDYS… |
| A0A1V4X3F7 | 29-138 | None |
| A0A1M3LA76 | 68-176 | None |
| A0A843H235 | 10-110 | None |
| A5D228 | 318-426 | None |
| A0A3D4HK67 | 34-139 | None |
| A0A850M299 | 210-319 | None |
| A0A366J796 | 4-102 | None |
| A0A7X6THP2 | 5-98 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.