DPCstruct | MC12779
Metacluster Properties and Pfam Annotations
| Number of structural domains | 26 |
|---|---|
| Mean domain length (aa) | 227 ± 39 aa |
| Standard deviation of domain lengths | 38.95 |
| Length coefficient of variation | 0.17 |
| Mean AlphaFold2 pLDDT confidence score | 80.74 |
| Mean fraction of residues predicted as intrinsically disordered | 0.41 |
| Mean length-normalized TM-Score | 0.41 |
| Mean intra-cluster local Distance Difference Test score | 0.70 |
| Mean intra-cluster sequence similarity (%) | 17.04 |
| Pfam Score | 95.00 |
| Assigned Pfam label(s) | CL0724- PF18504 |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A0M0JR07 | 8-222 | HARYETLVNLRETQPERAAAAATSALQKSRKSSEALIAALRAEIDAYKENKQLGCTASMPSDELTAARAESADLRRQLADARAKLAA… |
| J7S2J4 | 3-180 | ALQEYKDSVQERLNSADLLVSKAVHENSILTERLETQERELEALRKRVAELEVDCQGAKDDRNSSVEDLQVIKDFFSHLCDVRVHSR… |
| A0A1Y2HV75 | 165-413 | None |
| K3W6J4 | 1-150 | None |
| A0A6A5Y2B1 | 525-769 | None |
| A0A5C2SLQ2 | 63-322 | None |
| C1EAS6 | 232-541 | None |
| A0A2A9NVK0 | 15-252 | None |
| A0A7S2S7C1 | 121-428 | None |
| A0A0E9NBQ5 | 537-749 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.