DPCstruct | MC12778
Metacluster Properties and Pfam Annotations
| Number of structural domains | 10 |
|---|---|
| Mean domain length (aa) | 160 ± 14 aa |
| Standard deviation of domain lengths | 13.91 |
| Length coefficient of variation | 0.09 |
| Mean AlphaFold2 pLDDT confidence score | 80.26 |
| Mean fraction of residues predicted as intrinsically disordered | 0.42 |
| Mean length-normalized TM-Score | 0.80 |
| Mean intra-cluster local Distance Difference Test score | 0.76 |
| Mean intra-cluster sequence similarity (%) | 40.58 |
| Pfam Score | 0.00 |
| Assigned Pfam label(s) | UNKNOWN |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A7S3FIS0 | 7-147 | VEADGAAALHQRVAREAAARKLISNHANVLLDLTNASETLNIEGRPLTQQFVLRRVAPADRSFADEFLLELARRLLGRCSSVSWRVE… |
| A0A0M0JPA9 | 15-182 | LADLLSSGANMDAVGAAKAHTVSARTEAATKLIGNHKRVLMDLTNPSMSLTYDGLRKLTQTTLQRLPPVMVHQVDCCLREVCRRLLG… |
| A0A7S3TWM2 | 3-188 | None |
| A0A7S3ADU8 | 11-175 | None |
| A0A7S3TXB4 | 59-203 | None |
| A0A7S3TNT9 | 36-188 | None |
| A0A7S2GAZ8 | 101-274 | None |
| A0A7S3EZG3 | 47-190 | None |
| A0A7S3ERA8 | 31-197 | None |
| A0A7S4HFQ9 | 5-158 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.