DPCstruct | MC12777
Metacluster Properties and Pfam Annotations
| Number of structural domains | 38 |
|---|---|
| Mean domain length (aa) | 176 ± 25 aa |
| Standard deviation of domain lengths | 25.44 |
| Length coefficient of variation | 0.14 |
| Mean AlphaFold2 pLDDT confidence score | 76.12 |
| Mean fraction of residues predicted as intrinsically disordered | 0.40 |
| Mean length-normalized TM-Score | 0.72 |
| Mean intra-cluster local Distance Difference Test score | 0.71 |
| Mean intra-cluster sequence similarity (%) | 23.23 |
| Pfam Score | 100.00 |
| Assigned Pfam label(s) | PF10032 |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A7S2E8P5 | 8-148 | IMLPLSLAANKYLNAEDQNLIFMLRCAYGAMQCVILILVAYVYTQALALSKHKGHDSAIFVPPPPQPFADPNKKTYQEKTYGKHVKS… |
| A0A0M0JKJ6 | 155-340 | APAKPAMPPMQMHKMILGFIAPMAVMRVLKRFDQTSASYMLGLRCAFFGVIALNVFVQFLLQWRIRAANDTALMPAAPPNPLASLMG… |
| A0A2G8S3P9 | 57-232 | None |
| B7XPR7 | 9-153 | None |
| A0A7S1ZC81 | 50-254 | None |
| A0A1W0E824 | 10-174 | None |
| A0A0B7NGC3 | 1-137 | None |
| A0A0J0XNF4 | 7-219 | None |
| A0A093XLD5 | 8-192 | None |
| A0A1E7FBR3 | 145-331 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.